(Pro3) GIP, human ((Pro3)Gastric Inhibitory Peptide, human) is an efficacious, stable and specifichuman GIP receptor (hGIPR)full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with K_i/ K_dvalues of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes^[1][2].

EC50: 0.026 nM (hGIPR)^[2]
Ki/Kd: 0.90 nM (hGIPR); 1.1 nM (Rat GIPR); 0.72 nM (Mouse GIPR)^[2]

(Pro3) GIP, human induces cAMP accumulation with an EC₅₀value of 0.026 nM^[2].
(Pro3) GIP, human has high binding affinity for human GIPR, Rat GIPR and Mouse GIPR with K_i/ K_dvalues of 0.90 nM, 1.1 nM and 0.72 nM, respectively^[2].

(Pro3) GIP, human has comparatively weak partial agonist effect in rodent models^[2].

4951.53

C₂₂₆H₃₃₈N₆₀O₆₄S

299898-52-5

YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.