GIP (1-30) amide,human is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulatesinsulinsecretion and reduces postprandial glycaemic excursions. GIP (1-30) amide,human dose-dependently promotesinsulinsecretion over the range 10^-9-10^-6M^[1].

The glucose-dependent action of Glucose-dependent insulinotropic polypeptide (GIP) on pancreatic β-cells has attracted attention towards its exploitation as a potential drug for type 2 diabetes. In a 50% aqueous trifluoroethanol solvent, GIP(1-30) amide has an α-helical structural region from F6 to A28. The structures calculated for GIP(1-30) amide remain within one family of conformations and the level of agreement between the structures demonstrated the ordered arrangement^[1].

3531.94

C₁₆₂H₂₄₀N₄₀O₄₇S

198624-01-0

Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-NH2

YAEGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.